PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g30210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 385aa    MW: 41456.1 Da    PI: 8.4909
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g30210.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.17.8e-4196172278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      C v+gC++dls++++yhrrhkvCevhsk+++v++ g++qrfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+qa
  Vradi07g30210.1  96 CLVDGCHSDLSNCRDYHRRHKVCEVHSKTAQVTIGGQKQRFCQQCSRFHSLEEFDEGKRSCRKRLDGHNRRRRKPQA 172
                      **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-3390157IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.80493170IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.19E-3894173IPR004333Transcription factor, SBP-box
PfamPF031103.2E-3096169IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MDWNLKAASW DLSEVDQANL PNMETVEGSS RYGMFTSKGE FSVDLKLGQV GNSGTESVLT  60
KSKDAVGLSK ITSSSSSSGS SKRARALGNA TQTVSCLVDG CHSDLSNCRD YHRRHKVCEV  120
HSKTAQVTIG GQKQRFCQQC SRFHSLEEFD EGKRSCRKRL DGHNRRRRKP QAEPPLTRSG  180
SFLSNYQGTQ LLPFSSSHVY PSTTVMNPTW GGIVASGDVR IHGHNQQGEL FLGTSPTGYK  240
EGKQLAFLQA DQTLNNQSPH LAGAYVGQAH MFMRSGPYSE SSGLRCKMLC DSLTSSVHDS  300
SSRALSLLSS PQPHSPGNGL SQIVNPHSPL MQPLGLSLHD GNSLGPVDPV LGLNGSDHSS  360
SMYNIGSNGS QGNEAPPVFP FQWG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-28961691184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152169KRSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014509709.10.0PREDICTED: squamosa promoter-binding-like protein 13A
RefseqXP_014509710.10.0PREDICTED: squamosa promoter-binding-like protein 13A
TrEMBLA0A0L9VPU00.0A0A0L9VPU0_PHAAN; Uncharacterized protein
TrEMBLA0A0S3QXP00.0A0A0S3QXP0_PHAAN; Uncharacterized protein
STRINGGLYMA08G01450.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25913378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-71SBP family protein